(Answered) Question - three polypeptides listed below are in a mixture

Academics

Question - Three polypeptides listed below are in a mixture. Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly (i.e. elute first) through a strong anion-exchange resin at pH 7.0?

ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG

GPYFGDEPLDVHDEPEEG

PHLLSAWKGMEGVGKSQSFAALIVILA

View complete question

Chemistry, Academics

Category:- Chemistry
Reference No.:- M92515479
Price:- $25

Verified Expert

Priced at $50 Now at $25, Verified Solution

Have any Question?Write your Review or question?

Related Questions in Chemistry

What is the volume of a solution with a concentration of 12

What is the volume of a solution with a concentration of 1.2 M that contains 12 g of NaOH?

Suppose that a student is determining the total base

Suppose that a student is determining the total base content of an antacid tablet by performing a back titration. He/she weighs out a .3012g portion of a tablet whose total weight is 1.5312g, dissolves this in exactly 40 ...

A sample of caco3nbsps is introduced into a sealed

A sample of CaCO 3 (s) is introduced into a sealed container of volume .654 L and heated to 1000 K until equilibrium. The reaction is . K p for the reaction is3.9*10 -2 at this temperature. Calculate the mass of CaO(s ...

For each of the following reactions identify the oxidizing

For each of the following reactions identify the oxidizing agent and the reducing agent. 2Na(aq)+2H2O(l)→2NaOH(aq)+H2(g) C(s)+O2(g)→CO2(g) 2MnO-4(aq)+5SO2(g)+2H2O(l)→2Mn2+(aq)+5SO2-4(aq)+4H+(aq)

A 315-nbspsample ofnbspnh4no3nbspis introduced intoan

A 3.15- sample of NH4NO3 is introduced intoan evacuated 2.26- L flask and then heated to 245 C. What is the total gas pressure, in atmospheres, in the flask at245 C when the NH4NO3 has completely decomposed?

Consider the following reactioncog cl2nbspg

Consider the following reaction. CO(g) + Cl 2 (g) > COCl 2 (g) The mechanism is believed to be, (1) Cl 2 2Cl (fast equilibrium) (2) Cl + CO COCl (fast equilibrium) (3) COCl + Cl 2 > COCl 2 + Cl (slow) (4) ...

The reaction of solid dimethylhydrazine ch32n2h2 and

The reaction of solid dimethylhydrazine ((CH3)2N2H2) and liquefied dinitrogen tetroxide (N2O4) has been investigated as a rocket fuel; the reaction produces gaseous carbon dioxide (CO2) nitrogen (N2) and water vapor (H2O ...

The threshold wavelength for the photoelectric effect for

The threshold wavelength for the photoelectric effect for silver is 262nm. What is the work function for silver and what is the maximum KE of an emitted electron if the incident light has a wavelength of 212nm?

How many water molecules are associated with a single salt

How many water molecules are associated with a single salt molecule in a hexahydrate?

1 if congress taxes co2 production at 40 per ton of co2

1) If Congress taxes CO2 production at $40 per ton of CO2, what is the tax to burn one ton (2000 pounds) of coal which is 75% carbon? 2) How much heat energy can you get from burning that ton of coal? Take the book value ...

4,153,160 Questions Asked
13,132 Experts
2,558,936 Questions Answered

Ask Experts for help!!

Looking for Assignment Help?

Start excelling in your Courses, Get help with Assignment

Write us your full requirement for evaluation and you will receive response within 20 minutes turnaround time.

Ask Now Help with Problems, Get a Best Answer

Recent Questions

Ask Chemistry Expert